| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, liver |
|---|
| Ligand | BDBM50243721 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555396 (CHEMBL964793) |
|---|
| Kd | 2000±n/a nM |
|---|
| Citation |  Chuang, S; Velkov, T; Horne, J; Porter, CJ; Scanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, liver |
|---|
| Name: | Fatty acid-binding protein, liver |
|---|
| Synonyms: | FABP1 | FABPL | FABPL_HUMAN | Fatty acid-binding protein, liver | Liver fatty acid binding protein (human L-FABP T94T) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14208.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | human L-FABP |
|---|
| Residue: | 127 |
|---|
| Sequence: | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
|
|
|
|---|
| BDBM50243721 |
|---|
| n/a |
|---|
| Name | BDBM50243721 |
|---|
| Synonyms: | 1-anilinonaphthalene-8-sulfonic acid | CHEMBL471741 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13NO4S |
|---|
| Mol. Mass. | 315.344 |
|---|
| SMILES | OS(=O)(=O)Oc1cccc2cccc(Nc3ccccc3)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
