| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, intestinal |
|---|
| Ligand | BDBM28701 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555397 (CHEMBL964794) |
|---|
| Ki | 33000±n/a nM |
|---|
| Citation |  Chuang, S; Velkov, T; Horne, J; Porter, CJ; Scanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, intestinal |
|---|
| Name: | Fatty acid-binding protein, intestinal |
|---|
| Synonyms: | FABP2 | FABPI | FABPI_HUMAN | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP | Intestinal fatty acid-binding protein (hIFABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 15207.56 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 132 |
|---|
| Sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
|
|
|
|---|
| BDBM28701 |
|---|
| n/a |
|---|
| Name | BDBM28701 |
|---|
| Synonyms: | 2-(4-{2-[(4-chlorophenyl)formamido]ethyl}phenoxy)-2-methylpropanoic acid | Azufibrat | Bezafibrate | CHEMBL264374 | Cedur | Sklerofibrat |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20ClNO4 |
|---|
| Mol. Mass. | 361.819 |
|---|
| SMILES | CC(C)(Oc1ccc(CCNC(=O)c2ccc(Cl)cc2)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
