| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, liver |
|---|
| Ligand | BDBM19190 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_555398 (CHEMBL964795) |
|---|
| Ki | 101000±n/a nM |
|---|
| Citation |  Chuang, S; Velkov, T; Horne, J; Porter, CJ; Scanlon, MJ Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem51:3755-64 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, liver |
|---|
| Name: | Fatty acid-binding protein, liver |
|---|
| Synonyms: | FABPL_RAT | Fabp1 | Fatty acid-binding protein, liver | Liver fatty acid binding protein (rat L-FABP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14274.39 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | rat L-FABP |
|---|
| Residue: | 127 |
|---|
| Sequence: | MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIH
NEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
|---|
| BDBM19190 |
|---|
| n/a |
|---|
| Name | BDBM19190 |
|---|
| Synonyms: | (1S,2R,10S,11S,14R,15S,17S)-14,17-dihydroxy-14-(2-hydroxyacetyl)-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-3,6-dien-5-one | CHEMBL131 | Delta-Cortef | Deltacortril | Prednisolone | US10196374, Prednisolone |
|---|
| Type | Steroid |
|---|
| Emp. Form. | C21H28O5 |
|---|
| Mol. Mass. | 360.444 |
|---|
| SMILES | [H][C@@]12CC[C@](O)(C(=O)CO)[C@@]1(C)C[C@H](O)[C@@]1([H])[C@@]2([H])CCC2=CC(=O)C=C[C@]12C |r,c:27,t:23| |
|---|
| Structure | 
|
|---|
Search and Browse
