Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50007102 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_558752 (CHEMBL1019881) |
---|
Ki | 0.190000±n/a nM |
---|
Citation | Wentland, MP; Lou, R; Lu, Q; Bu, Y; VanAlstine, MA; Cohen, DJ; Bidlack, JM Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett19:203-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50007102 |
---|
n/a |
---|
Name | BDBM50007102 |
Synonyms: | 6,11-Dimethyl-3-(tetrahydro-furan-2-ylmethyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL79470 | MR-2034 |
Type | Small organic molecule |
Emp. Form. | C19H27NO2 |
Mol. Mass. | 301.4232 |
SMILES | C[C@H]1[C@H]2Cc3ccc(O)cc3[C@@]1(C)CCN2C[C@@H]1CCCO1 |THB:16:15:1:10.4.3| |
Structure |
|