| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50222793 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_560595 (CHEMBL1022320) |
|---|
| Ki | 11.1±n/a nM |
|---|
| Citation |  Markt, P; Feldmann, C; Rollinger, JM; Raduner, S; Schuster, D; Kirchmair, J; Distinto, S; Spitzer, GM; Wolber, G; Laggner, C; Altmann, KH; Langer, T; Gertsch, J Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow. J Med Chem52:369-78 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50222793 |
|---|
| n/a |
|---|
| Name | BDBM50222793 |
|---|
| Synonyms: | (4-(ethylsulfonyl)-2-propyl-1,2,3,4-tetrahydropyrrolo[3,4-b]indol-7-yl)(4-methylpiperidin-1-yl)methanone | CHEMBL400399 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31N3O3S |
|---|
| Mol. Mass. | 417.565 |
|---|
| SMILES | CCCN1Cc2c(C1)c1cc(ccc1n2S(=O)(=O)CC)C(=O)N1CCC(C)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
