Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic Alpha
LigandBDBM50010859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_534654
IC50 17100±n/a nM
Citation Ahlin GKarlsson JPedersen JMGustavsson LLarsson RMatsson PNorinder UBergström CAArtursson P Structural requirements for drug inhibition of the liver specific human organic cation transport protein 1. J Med Chem 51:5932-42 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic Alpha
Name:Solute carrier family 22 member 1
Synonyms:Organic cation transporter 1 | Solute carrier family 22 member 1 | hOCT1
Type:Enzyme Catalytic Domain
Mol. Mass.:61154.85
Organism:Homo sapiens (Human)
Description:Adrenergic Alpha 0 HUMAN::O15245
Residue:554
Sequence:
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010859
n/a
NameBDBM50010859
Synonyms:CHEMBL11 | IMIPRAMINE HYDROCHLORIDE | IMIPRAMINE PAMOATE | Imipramin
TypeSmall organic molecule
Emp. Form.C19H24N2
Mol. Mass.280.4073
SMILESCN(C)CCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: