Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50252728 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_539509 (CHEMBL1032318) |
---|
IC50 | 400±n/a nM |
---|
Citation | Vougogiannopoulou, K; Ferandin, Y; Bettayeb, K; Myrianthopoulos, V; Lozach, O; Fan, Y; Johnson, CH; Magiatis, P; Skaltsounis, AL; Mikros, E; Meijer, L Soluble 3',6-substituted indirubins with enhanced selectivity toward glycogen synthase kinase -3 alter circadian period. J Med Chem51:6421-31 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50252728 |
---|
n/a |
---|
Name | BDBM50252728 |
Synonyms: | (2'Z-3'E)-6-Bromoindirubin-3'-[O-(2-piperazine-1-ylethyl)oxime] | CHEMBL3216892 | CHEMBL523714 |
Type | Small organic molecule |
Emp. Form. | C24H28BrCl2N5O3 |
Mol. Mass. | 585.321 |
SMILES | Cl.Cl.OCCN1CCN(CCO\N=C2\C(\Nc3ccccc\23)=C2\C(=O)Nc3cc(Br)ccc23)CC1 |
Structure |
|