| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50252976 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_539509 (CHEMBL1032318) |
|---|
| IC50 | 490±n/a nM |
|---|
| Citation |  Vougogiannopoulou, K; Ferandin, Y; Bettayeb, K; Myrianthopoulos, V; Lozach, O; Fan, Y; Johnson, CH; Magiatis, P; Skaltsounis, AL; Mikros, E; Meijer, L Soluble 3',6-substituted indirubins with enhanced selectivity toward glycogen synthase kinase -3 alter circadian period. J Med Chem51:6421-31 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50252976 |
|---|
| n/a |
|---|
| Name | BDBM50252976 |
|---|
| Synonyms: | (2'Z-3'E)-6-Bromoindirubin-3'-[O-(2-dimethylaminoethyl)-oxime] | CHEMBL494481 | CHEMBL521834 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19BrN4O2 |
|---|
| Mol. Mass. | 427.294 |
|---|
| SMILES | CN(C)CCO\N=C1\C(\Nc2ccccc\12)=C1\C(=O)Nc2cc(Br)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
