Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine nucleoside phosphorylase
LigandBDBM50247158
Substrate/Competitorn/a
Meas. Tech.ChEMBL_519471
Ki 380±n/a nM
Citation Clinch KEvans GBFröhlich RFFurneaux RHKelly PMLegentil LMurkin ASLi LSchramm VLTyler PCWoolhouse AD Third-generation immucillins: syntheses and bioactivities of acyclic immucillin inhibitors of human purine nucleoside phosphorylase. J Med Chem 52:1126-43 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine nucleoside phosphorylase
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:Enzyme
Mol. Mass.:32119.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50247158
n/a
NameBDBM50247158
Synonyms:7-(((3S,4S)-3-hydroxy-4-(hydroxymethyl)pyrrolidin-1-yl)methyl)-3H-pyrrolo[3,2-d]pyrimidin-4(5H)-one | CHEMBL454743
TypeSmall organic molecule
Emp. Form.C12H16N4O3
Mol. Mass.264.2804
SMILESOC[C@@H]1CN(Cc2c[nH]c3c2nc[nH]c3=O)C[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: