Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM25904
Substrate/Competitorn/a
Meas. Tech.ChEMBL_565864
Ki 2633±n/a nM
Citation Crocetti LMaresca ATemperini CHall RAScozzafava AMühlschlegel FASupuran CT A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases. Bioorg Med Chem Lett 19:1371-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25904
n/a
NameBDBM25904
Synonyms:2-(hydrazinecarbonyl)-3-phenyl-1H-indole-5-sulfonamide | BMC173212 Compound 1 | CHEMBL262628 | indole sulfonamide, L
TypeSmall organic molecule
Emp. Form.C15H14N4O3S
Mol. Mass.330.362
SMILESNNC(=O)c1[nH]c2ccc(cc2c1-c1ccccc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: