Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM27216 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_563791 (CHEMBL993554) |
---|
IC50 | 4±n/a nM |
---|
Citation | Gray, NS; Wodicka, L; Thunnissen, AM; Norman, TC; Kwon, S; Espinoza, FH; Morgan, DO; Barnes, G; LeClerc, S; Meijer, L; Kim, SH; Lockhart, DJ; Schultz, PG Exploiting chemical libraries, structure, and genomics in the search for kinase inhibitors. Science281:533-538 (1998) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM27216 |
---|
n/a |
---|
Name | BDBM27216 |
Synonyms: | (2R)-2-({6-[(3-chlorophenyl)amino]-9-(propan-2-yl)-9H-purin-2-yl}amino)-3-methylbutan-1-ol | 2,6,9-Trisubstitute purine, 1 | CHEMBL23327 | Purvalanol A |
Type | Small organic molecule |
Emp. Form. | C19H25ClN6O |
Mol. Mass. | 388.894 |
SMILES | CC(C)[C@H](CO)Nc1nc(Nc2cccc(Cl)c2)c2ncn(C(C)C)c2n1 |
Structure |
|