| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50268085 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_520170 (CHEMBL947858) |
|---|
| Ki | 35±n/a nM |
|---|
| Citation |  Borrmann, T; Hinz, S; Bertarelli, DC; Li, W; Florin, NC; Scheiff, AB; Müller, CE 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with subnanomolar affinity and subtype specificity. J Med Chem52:3994-4006 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36704.13 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
|---|
| BDBM50268085 |
|---|
| n/a |
|---|
| Name | BDBM50268085 |
|---|
| Synonyms: | CHEMBL490262 | CHEMBL521280 | N-(2-hydroxyethyl)-2-(4-(1-methyl-2,4-dioxo-3-propyl-2,3,4,5-tetrahydro-1H-pyrrolo[3,2-d]pyrimidin-6-yl)phenoxy)acetamide | SB-298 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N4O5 |
|---|
| Mol. Mass. | 400.4284 |
|---|
| SMILES | CCCn1c(=O)n(C)c2cc([nH]c2c1=O)-c1ccc(OCC(=O)NCCO)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
