| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM81982 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588703 (CHEMBL1059312) |
|---|
| Ki | 88.5±n/a nM |
|---|
| Citation |  Berardi, F; Abate, C; Ferorelli, S; Uricchio, V; Colabufo, NA; Niso, M; Perrone, R Exploring the importance of piperazine N-atoms for sigma(2) receptor affinity and activity in a series of analogs of 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl]piperazine (PB28). J Med Chem52:7817-28 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM81982 |
|---|
| n/a |
|---|
| Name | BDBM81982 |
|---|
| Synonyms: | CAS_97-39-2 | DITOLYLGUANIDINE | DTG | Di-o-tolylguanidine | Tol2Gdn | cid_7333 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H17N3 |
|---|
| Mol. Mass. | 239.3156 |
|---|
| SMILES | Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11| |
|---|
| Structure | 
|
|---|
Search and Browse
