| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50299721 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588694 (CHEMBL1056845) |
|---|
| Ki | >5000±n/a nM |
|---|
| Citation |  Berardi, F; Abate, C; Ferorelli, S; Uricchio, V; Colabufo, NA; Niso, M; Perrone, R Exploring the importance of piperazine N-atoms for sigma(2) receptor affinity and activity in a series of analogs of 1-cyclohexyl-4-[3-(5-methoxy-1,2,3,4-tetrahydronaphthalen-1-yl)propyl]piperazine (PB28). J Med Chem52:7817-28 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50299721 |
|---|
| n/a |
|---|
| Name | BDBM50299721 |
|---|
| Synonyms: | 1-cyclohexylpiperazine | CHEMBL574165 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H22N2O |
|---|
| Mol. Mass. | 210.3159 |
|---|
| SMILES | CC(=O)N1CCN(CC1)C1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
