Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 2 |
---|
Ligand | BDBM10861 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_588928 (CHEMBL1063843) |
---|
Ki | 29100±n/a nM |
---|
Citation | Carta, F; Maresca, A; Covarrubias, AS; Mowbray, SL; Jones, TA; Supuran, CT Carbonic anhydrase inhibitors. Characterization and inhibition studies of the most active beta-carbonic anhydrase from Mycobacterium tuberculosis, Rv3588c. Bioorg Med Chem Lett19:6649-54 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 2 |
---|
Name: | Carbonic anhydrase 2 |
Synonyms: | β-Carbonic anhydrase 2 (CA 2) | Carbonic anhydrase | MTCA2_MYCTU | canB | cynT | mtcA2 |
Type: | Enzyme |
Mol. Mass.: | 21788.97 |
Organism: | Mycobacterium tuberculosis |
Description: | P9WPJ9 |
Residue: | 207 |
Sequence: | MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEI
IFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDG
TLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSL
AIVGVTYQLDDGRAVLRDHIGNIGEEV
|
|
|
BDBM10861 |
---|
n/a |
---|
Name | BDBM10861 |
Synonyms: | 4-(2-aminoethyl)benzene-1-sulfonamide | CHEMBL7087 | aromatic sulfonamide compound 7 | aromatic/heteroaromatic sulfonamide 6 |
Type | Small organic molecule |
Emp. Form. | C8H12N2O2S |
Mol. Mass. | 200.258 |
SMILES | NCCc1ccc(cc1)S(N)(=O)=O |
Structure |
|