| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 2 |
|---|
| Ligand | BDBM11638 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_588928 (CHEMBL1063843) |
|---|
| Ki | 266±n/a nM |
|---|
| Citation |  Carta, F; Maresca, A; Covarrubias, AS; Mowbray, SL; Jones, TA; Supuran, CT Carbonic anhydrase inhibitors. Characterization and inhibition studies of the most active beta-carbonic anhydrase from Mycobacterium tuberculosis, Rv3588c. Bioorg Med Chem Lett19:6649-54 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 2 |
|---|
| Name: | Carbonic anhydrase 2 |
|---|
| Synonyms: | β-Carbonic anhydrase 2 (CA 2) | Carbonic anhydrase | MTCA2_MYCTU | canB | cynT | mtcA2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21788.97 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | P9WPJ9 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEI
IFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDG
TLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSL
AIVGVTYQLDDGRAVLRDHIGNIGEEV
|
|
|
|---|
| BDBM11638 |
|---|
| n/a |
|---|
| Name | BDBM11638 |
|---|
| Synonyms: | CHEMBL26 | Compound 7 | N-[(1-ethylpyrrolidin-2-yl)methyl]-2-methoxy-5-sulfamoylbenzamide | SULPIRIDE,(+) | SULPIRIDE,(-) | Sulpiride | Sulpiride, SLP | Sulpiride-R | US10172837, Sulpiride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23N3O4S |
|---|
| Mol. Mass. | 341.426 |
|---|
| SMILES | CCN1CCCC1CNC(=O)c1cc(ccc1OC)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
