| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator ExsA |
|---|
| Ligand | BDBM50378359 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_592474 (CHEMBL1043190) |
|---|
| IC50 | 6700±n/a nM |
|---|
| Citation |  Kim, OK; Garrity-Ryan, LK; Bartlett, VJ; Grier, MC; Verma, AK; Medjanis, G; Donatelli, JE; Macone, AB; Tanaka, SK; Levy, SB; Alekshun, MN N-hydroxybenzimidazole inhibitors of the transcription factor LcrF in Yersinia: novel antivirulence agents. J Med Chem52:5626-34 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator ExsA |
|---|
| Name: | HTH-type transcriptional regulator ExsA |
|---|
| Synonyms: | EXSA_PSEAE | Exoenzyme S synthesis regulatory protein exsA | exsA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31648.37 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_635526 |
|---|
| Residue: | 278 |
|---|
| Sequence: | MQGAKSLGRKQITSCHWNIPTFEYRVNKEEGVYVLLEGELTVQDIDSTFCLAPGELLFVR
RGSYVVSTKGKDSRILWIPLSAQFLQGFVQRFGALLSEVERCDEPVPGIIAFAATPLLAG
CVKGLKELLVHEHPPMLACLKIEELLMLFAFSPQGPLLMSVLRQLSNRHVERLQLFMEKH
YLNEWKLSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIA
MEAGFSSQSYFTQSYRRRFGCTPSRSRQGKDECRAKNN
|
|
|
|---|
| BDBM50378359 |
|---|
| n/a |
|---|
| Name | BDBM50378359 |
|---|
| Synonyms: | CHEMBL575963 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H17FN4O4 |
|---|
| Mol. Mass. | 432.4039 |
|---|
| SMILES | Cc1cc2nc(-c3ccc(NC(=O)\C=C\c4ccc(F)cc4)cc3)n(O)c2cc1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
