Reaction Details |
| Report a problem with these data |
Target | Beta-carbonic anhydrase 1 |
---|
Ligand | BDBM33273 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_599731 (CHEMBL1048175) |
---|
Ki | 7000±n/a nM |
---|
Citation | Maresca, A; Carta, F; Vullo, D; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Inhibition of the Rv1284 and Rv3273 beta-carbonic anhydrases from Mycobacterium tuberculosis with diazenylbenzenesulfonamides. Bioorg Med Chem Lett19:4929-32 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Beta-carbonic anhydrase 1 |
---|
Name: | Beta-carbonic anhydrase 1 |
Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
Type: | Enzyme |
Mol. Mass.: | 18186.06 |
Organism: | Mycobacterium tuberculosis |
Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
Residue: | 163 |
Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
BDBM33273 |
---|
n/a |
---|
Name | BDBM33273 |
Synonyms: | azo-sulfonamide, 2b |
Type | Small organic molecule |
Emp. Form. | C12H12N4O2S |
Mol. Mass. | 276.314 |
SMILES | Nc1ccc(cc1)\N=N\c1cccc(c1)S(N)(=O)=O |
Structure |
|