| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM81982 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_599822 (CHEMBL1042781) |
|---|
| Ki | 61±n/a nM |
|---|
| Citation |  Jasper, A; Schepmann, D; Lehmkuhl, K; Vela, JM; Buschmann, H; Holenz, J; Wünsch, B Synthesis of sigma receptor ligands with unsymmetrical spiro connection of the piperidine moiety. Eur J Med Chem44:4306-14 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM81982 |
|---|
| n/a |
|---|
| Name | BDBM81982 |
|---|
| Synonyms: | CAS_97-39-2 | DITOLYLGUANIDINE | DTG | Di-o-tolylguanidine | Tol2Gdn | cid_7333 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H17N3 |
|---|
| Mol. Mass. | 239.3156 |
|---|
| SMILES | Cc1ccccc1NC(N)=Nc1ccccc1C |w:10.11| |
|---|
| Structure | 
|
|---|
Search and Browse
