Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50300203
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595951
Ki 3800±n/a nM
Citation Maresca ATemperini CPochet LMasereel BScozzafava ASupuran CT Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem 53:335-44 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300203
n/a
NameBDBM50300203
Synonyms:(S)-6-(1-hydroxy-3-methylbutyl)-7-methoxy-2H-chromen-2-one | 6-(1S-hydroxy-3-methylbutyl)-7-methoxy-2H-chromen-2-one | CHEMBL572366
TypeSmall organic molecule
Emp. Form.C15H18O4
Mol. Mass.262.301
SMILESCOc1cc2oc(=O)ccc2cc1[C@@H](O)CC(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: