Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50274257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603980
Ki 0.225±n/a nM
Citation Nagase HWatanabe ANemoto TYamaotsu NHayashida KNakajima MHasebe KNakao KMochizuki HHirono SFujii H Drug design and synthesis of a novel kappa opioid receptor agonist with an oxabicyclo[2.2.2]octane skeleton and its pharmacology. Bioorg Med Chem Lett 20:121-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50274257
n/a
NameBDBM50274257
Synonyms:(2E)-N-[(1S,5R,13R,14R,17S)-4-(cyclopropylmethyl)-10,17-dihydroxy-12-oxa-4-azapentacyclo[9.6.1.0^{1,13}.0^{5,17}.0^{7,18}]octadeca-7,9,11(18)-trien-14-yl]-3-(furan-2-yl)-N-methylprop-2-enamide | (2E)-N-[(5R,6R)-17-(Cyclopropylmethyl)-4,5-epoxy-3,14-dihydroxymorphinan-6-yl]-3-(furan-2-yl)-N-methylprop-2-enamide | CHEMBL485605 | TRK-820
TypeSmall organic molecule
Emp. Form.C28H32N2O5
Mol. Mass.476.5641
SMILESCN([C@@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45)C(=O)\C=C\c1ccco1 |r,TLB:4:5:9.25.8:18.20.19,THB:6:5:9.25.8:18.20.19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: