Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM50273360
Substrate/Competitorn/a
Meas. Tech.ChEMBL_610349
Ki 2.8±n/a nM
Citation Robertson CRScholl EAPruess THGreen BRWhite HSBulaj G Engineering galanin analogues that discriminate between GalR1 and GalR2 receptor subtypes and exhibit anticonvulsant activity following systemic delivery. J Med Chem 53:1871-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GALR1
Name:GALR1
Synonyms:GAL1-R | Galanin R1 | Galanin receptor 1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38976.60
Organism:Homo sapiens (Human)
Description:Galanin R1 GALR1 HUMAN::P47211
Residue:349
Sequence:
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273360
n/a
NameBDBM50273360
Synonyms:(S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,6-diamino-1-oxohexan-2-ylamino)-1-oxo-6-palmitamidohexan-2-ylamino)-1-oxohexan-2-ylamino)-1-oxohexan-2-yl)-1-(2-((S)-2-((S)-2-((S)-2-(2-((S)-2-((S)-2-((S)-4-amino-2-((S)-2-((2S,3R)-2-((S)-2-(2-aminoacetamido)-3-(1H-indol-3-yl)propanamido)-3-hydroxybutanamido)-4-methylpentanamido)-4-oxobutanamido)-3-hydroxypropanamido)propanamido)acetamido)-3-(4-hydroxyphenyl)propanamido)-4-methylpentanamido)-4-methylpentanamido)acetyl)pyrrolidine-2-carboxamide | CHEMBL499807 | [Sar1Gly]GAL-B2
TypeSmall organic molecule
Emp. Form.C103H172N24O22
Mol. Mass.2098.6154
SMILESCCCCCCCCCCCCCCCC(=O)NCCCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: