Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVesicular acetylcholine transporter
LigandBDBM50378723
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627490
Ki 0.54±n/a nM
Citation Efange SMKhare ABvon Hohenberg KMach RHParsons SMTu Z Synthesis and in vitro biological evaluation of carbonyl group-containing inhibitors of vesicular acetylcholine transporter. J Med Chem 53:2825-35 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vesicular acetylcholine transporter
Name:Vesicular acetylcholine transporter
Synonyms:TorVAChT | VAChT
Type:PROTEIN
Mol. Mass.:56111.93
Organism:Torpedo californica
Description:ChEMBL_1503355
Residue:515
Sequence:
MGVTMAVGLAKAAMGKISSAIGERSKRISGAMNEPRRKRKILLVIVCIAMLLDNMLYMVI
VPIIPNYLETIRTYKLVYITTPSNGTNGSLLNSTQRAVLERNPNANEDIQIGVLFASKAI
LQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAVLFAARSLQGLGSAFAD
TSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFLVLSFVCL
LDGILLLMVVTPFASRTRENMLQGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTISNW
MKKTMNASEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWFYGAVGLVIIGASSCTIP
ACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALG
PIMAGQIVHDLGFVQLNLGMGLVNILYAPALLFLRNVCQMKPSLSERNILLEEGPKGLYD
TIIMEERKAAKEPHGSSSGNHSVHAVLSDQEGYSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50378723
n/a
NameBDBM50378723
Synonyms:CHEMBL1204037
TypeSmall organic molecule
Emp. Form.C20H22BrNO2S
Mol. Mass.420.363
SMILESO[C@@H]1Cc2ccccc2C[C@H]1N1CCC(CC1)C(=O)c1ccc(Br)s1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: