| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-5 |
|---|
| Ligand | BDBM50354850 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_642275 (CHEMBL1177155) |
|---|
| IC50 | 26800±n/a nM |
|---|
| Citation |  Thanigaimalai, P; Lee, KC; Sharma, VK; Yun, JH; Kim, Y; Jung, SH Design and synthesis of novel hydroxyalkylaminomethylchromones for their IL-5 inhibitory activity. Bioorg Med Chem18:4625-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-5 |
|---|
| Name: | Interleukin-5 |
|---|
| Synonyms: | IL5 | IL5_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15240.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_642275 |
|---|
| Residue: | 134 |
|---|
| Sequence: | MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
|
|
|
|---|
| BDBM50354850 |
|---|
| n/a |
|---|
| Name | BDBM50354850 |
|---|
| Synonyms: | BUDESONIDE | US10869929, Compound Budesonide | US11554172, Compound Budesonide | US11760775, Compound Budesonide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H34O6 |
|---|
| Mol. Mass. | 430.5339 |
|---|
| SMILES | CCCC1O[C@@H]2C[C@H]3[C@@H]4CCC5=CC(=O)C=C[C@]5(C)[C@H]4[C@@H](O)C[C@]3(C)[C@@]2(O1)C(=O)CO |r,c:15,t:11| |
|---|
| Structure | 
|
|---|
Search and Browse
