Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50336768
Substrate/Competitorn/a
Meas. Tech.ChEMBL_718668
IC50 10000±n/a nM
Citation Baqi YHausmann RRosefort CRettinger JSchmalzing GMüller CE Discovery of potent competitive antagonists and positive modulators of the P2X2 receptor. J Med Chem 54:817-30 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336768
n/a
NameBDBM50336768
Synonyms:CHEMBL1671995 | sodium 1-amino-4-(3-methoxyphenylamino)-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C21H15N2O6S
Mol. Mass.423.419
SMILESCOc1cccc(Nc2cc(c(N)c3C(=O)c4ccccc4C(=O)c23)S([O-])(=O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: