| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 14-3-3 protein gamma |
|---|
| Ligand | BDBM50383920 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_819534 (CHEMBL2033507) |
|---|
| IC50 | 2000±n/a nM |
|---|
| Citation |  Yan, YM; Dai, HQ; Du, Y; Schneider, B; Guo, H; Li, DP; Zhang, LX; Fu, H; Dong, XP; Cheng, YX Identification of blapsins A and B as potent small-molecule 14-3-3 inhibitors from the insect Blaps japanensis. Bioorg Med Chem Lett22:4179-81 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 14-3-3 protein gamma |
|---|
| Name: | 14-3-3 protein gamma |
|---|
| Synonyms: | 1433G_HUMAN | YWHAG | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 28289.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_21464101 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
|
|
|
|---|
| BDBM50383920 |
|---|
| n/a |
|---|
| Name | BDBM50383920 |
|---|
| Synonyms: | CHEMBL2031675 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16O6 |
|---|
| Mol. Mass. | 304.2946 |
|---|
| SMILES | Oc1ccc(CCOC(=O)Cc2ccc(O)c(O)c2)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
