| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 8 |
|---|
| Ligand | BDBM50384745 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_821036 (CHEMBL2039223) |
|---|
| IC50 | 5200±n/a nM |
|---|
| Citation |  Turner, EM; Blazer, LL; Neubig, RR; Husbands, SM Small Molecule Inhibitors of Regulator of G Protein Signalling (RGS) Proteins. ACS Med Chem Lett3:146-150 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Regulator of G-protein signaling 8 |
|---|
| Name: | Regulator of G-protein signaling 8 |
|---|
| Synonyms: | RGS8 | RGS8_HUMAN | Regulator of G-protein signaling 8 (RGS8) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20925.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_74355113 |
|---|
| Residue: | 180 |
|---|
| Sequence: | MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
|
|
|
|---|
| BDBM50384745 |
|---|
| n/a |
|---|
| Name | BDBM50384745 |
|---|
| Synonyms: | CHEMBL2037237 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H11ClN2O2S |
|---|
| Mol. Mass. | 318.778 |
|---|
| SMILES | Clc1ccc(cc1)-n1sc(=O)n(Cc2ccccc2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
