Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
LigandBDBM50385314
Substrate/Competitorn/a
Meas. Tech.ChEMBL_822688
Ki 40±n/a nM
Citation Bell IMStump CAGallicchio SNStaas DDZartman CBMoore ELSain NUrban MBruno JGCalamari AKemmerer ALMosser SDFandozzi CWhite RBZrada MMSelnick HGGraham SLVacca JPKane SASalvatore CA MK-8825: a potent and selective CGRP receptor antagonist with good oral activity in rats. Bioorg Med Chem Lett 22:3941-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Name:Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Synonyms:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 327200
Components:This complex has 2 components.
Component 1
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16992.80
Organism:Homo sapiens (Human)
Description:EBI_100673
Residue:148
Sequence:
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385314
n/a
NameBDBM50385314
Synonyms:CHEMBL2035981
TypeSmall organic molecule
Emp. Form.C32H31F2N5O3
Mol. Mass.571.617
SMILESC[C@]1(CNC2(CCCC2)C(=O)N1CC(=O)Nc1ccc2C[C@]3(Cc2c1)C(=O)Nc1ncccc31)c1cc(F)cc(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: