Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM26613 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_829767 (CHEMBL2061286) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Mak, LH; Knott, J; Scott, KA; Scott, C; Whyte, GF; Ye, Y; Mann, DJ; Ces, O; Stivers, J; Woscholski, R Arylstibonic acids are potent and isoform-selective inhibitors of Cdc25a and Cdc25b phosphatases. Bioorg Med Chem20:4371-6 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM26613 |
---|
n/a |
---|
Name | BDBM26613 |
Synonyms: | (2E)-3-{3-[dihydroxy(oxo)--stibanyl]phenyl}prop-2-enoic acid | Compound 13778 |
Type | Small organic molecule |
Emp. Form. | C9H9O5Sb |
Mol. Mass. | 318.92 |
SMILES | OC(=O)\C=C\c1cccc(c1)[Sb](O)(O)=O |
Structure |
|