Reaction Details |
| Report a problem with these data |
Target | Ketohexokinase |
---|
Ligand | BDBM50389321 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_831738 (CHEMBL2065101) |
---|
IC50 | 28±n/a nM |
---|
Citation | Maryanoff, BE; O'Neill, JC; McComsey, DF; Yabut, SC; Luci, DK; Gibbs, AC; Connelly, MA Pyrimidinopyrimidine inhibitors of ketohexokinase: exploring the ring C2 group that interacts with Asp-27B in the ligand binding pocket. Bioorg Med Chem Lett22:5326-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ketohexokinase |
---|
Name: | Ketohexokinase |
Synonyms: | Hepatic fructokinase | KHK | KHK_HUMAN | Ketohexokinase | Ketohexokinase (KHK) | Ketohexokinase (KHK) Isoform C |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 32521.64 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 298 |
Sequence: | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
BDBM50389321 |
---|
n/a |
---|
Name | BDBM50389321 |
Synonyms: | CHEMBL2063927 |
Type | Small organic molecule |
Emp. Form. | C26H35N9S |
Mol. Mass. | 505.681 |
SMILES | CSc1ccccc1Nc1nc(nc2c(NCC3CC3)ncnc12)N1CCC(CC1)N1CCNCC1 |
Structure |
|