Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50068454 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_834665 (CHEMBL2072551) |
---|
Ki | 1.4±n/a nM |
---|
Citation | Moussa, IA; Banister, SD; Manoli, M; Doddareddy, MR; Cui, J; Mach, RH; Kassiou, M Exploration of ring size in a series of cyclic vicinal diamines withs1 receptor affinity. Bioorg Med Chem Lett22:5493-7 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50068454 |
---|
n/a |
---|
Name | BDBM50068454 |
Synonyms: | 1-[2-(3-Methoxy-phenyl)-ethyl]-4-(3-phenyl-propyl)-piperazine | CHEMBL358116 |
Type | Small organic molecule |
Emp. Form. | C22H30N2O |
Mol. Mass. | 338.4864 |
SMILES | COc1cccc(CCN2CCN(CCCc3ccccc3)CC2)c1 |
Structure |
|