| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Intracellular chorismate mutase |
|---|
| Ligand | BDBM50390440 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_834286 (CHEMBL2073106) |
|---|
| IC50 | 23880±n/a nM |
|---|
| Citation |  Adepu, R; Shiva Kumar, K; Sandra, S; Rambabu, D; Rama Krishna, G; Malla Reddy, C; Kandale, A; Misra, P; Pal, M C-N bond formation under Cu-catalysis: synthesis and in vitro evaluation of N-aryl substituted thieno[2,3-d]pyrimidin-4(3H)-ones against chorismate mutase. Bioorg Med Chem20:5127-38 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Intracellular chorismate mutase |
|---|
| Name: | Intracellular chorismate mutase |
|---|
| Synonyms: | CHMU_MYCTU | MT0975 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11771.52 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_834286 |
|---|
| Residue: | 105 |
|---|
| Sequence: | MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKA
RMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH
|
|
|
|---|
| BDBM50390440 |
|---|
| n/a |
|---|
| Name | BDBM50390440 |
|---|
| Synonyms: | CHEMBL2071373 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N3O4S |
|---|
| Mol. Mass. | 411.474 |
|---|
| SMILES | CC(C)(C)OC(=O)N1CCc2c(C1)sc1ncn(-c3cccc(C=O)c3)c(=O)c21 |
|---|
| Structure | 
|
|---|
Search and Browse
