Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50390853
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835804
Ki 0.05±n/a nM
Citation Wadsworth HJones PAChau WFDurrant CMorisson-Iveson VPassmore JO'Shea DWynn DKhan IBlack AAvory MTrigg W Exploration of the structure-activity relationship of the diaryl anilide class of ligands for translocator protein--potential novel positron emitting tomography imaging agents. Bioorg Med Chem Lett 22:5795-800 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390853
n/a
NameBDBM50390853
Synonyms:CHEMBL2070800
TypeSmall organic molecule
Emp. Form.C23H21F2NO4
Mol. Mass.413.4139
SMILESCOc1ccc(OC)c(CN(C(=O)CF)c2cc(F)ccc2Oc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: