Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50390859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_835804 (CHEMBL2071915) |
---|
Ki | 1.02±n/a nM |
---|
Citation | Wadsworth, H; Jones, PA; Chau, WF; Durrant, C; Morisson-Iveson, V; Passmore, J; O'Shea, D; Wynn, D; Khan, I; Black, A; Avory, M; Trigg, W Exploration of the structure-activity relationship of the diaryl anilide class of ligands for translocator protein--potential novel positron emitting tomography imaging agents. Bioorg Med Chem Lett22:5795-800 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50390859 |
---|
n/a |
---|
Name | BDBM50390859 |
Synonyms: | CHEMBL2070806 |
Type | Small organic molecule |
Emp. Form. | C22H21FN2O3 |
Mol. Mass. | 380.4121 |
SMILES | CC(=O)N(Cc1cccnc1OCCF)c1ccccc1Oc1ccccc1 |
Structure |
|