| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM50390996 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_836853 (CHEMBL2075491) |
|---|
| Ki | 68±n/a nM |
|---|
| Citation |  Hallén, S; Björquist, A; Ostlund-Lindqvist, AM; Sachs, G Identification of a region of the ileal-type sodium/bile acid cotransporter interacting with a competitive bile acid transport inhibitor. Biochemistry41:14916-14924 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2_MOUSE | Na(+)-dependent ileal bile acid transporter | Ntcp2 | Slc10a2 | Sodium/taurocholate cotransporting polypeptide, ileal | Solute carrier family 10 member 2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38130.25 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_963356 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLG
HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID
GDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGM
FVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSL
GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF
AAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK
|
|
|
|---|
| BDBM50390996 |
|---|
| n/a |
|---|
| Name | BDBM50390996 |
|---|
| Synonyms: | CHEMBL2074988 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO2S |
|---|
| Mol. Mass. | 357.51 |
|---|
| SMILES | CCCC[C@]1(CC)CS(=O)(=O)c2ccccc2[C@H](N1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
