Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 2B1
LigandBDBM5446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860288
Ki 530±n/a nM
Citation Karlgren MVildhede ANorinder UWisniewski JRKimoto ELai YHaglund UArtursson P Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem 55:4740-63 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 2B1
Name:Solute carrier organic anion transporter family member 2B1
Synonyms:KIAA0880 | OATP-B | OATP-RP2 | OATP2B1 | OATPB | OATPRP2 | Organic anion transporter B | Organic anion transporter polypeptide-related protein 2 | SLC21A9 | SLCO2B1 | Solute carrier family 21 member 9
Type:PROTEIN
Mol. Mass.:76729.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488531
Residue:709
Sequence:
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5446
n/a
NameBDBM5446
Synonyms:CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | Erotinib | N-(3-Ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine Monohydrochloride | N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)quinazolin-4-amine | OSI-774 | Tarceva | US10189853, erlotinib | US9409845, Table 1, Compound 22: erlotinib | US9730934, Erlotinib | cid_176870
TypeSmall organic molecule
Emp. Form.C22H23N3O4
Mol. Mass.393.4357
SMILESCOCCOc1cc2ncnc(Nc3cccc(c3)C#C)c2cc1OCCOC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: