Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 5A |
---|
Ligand | BDBM16673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_858218 (CHEMBL2167681) |
---|
Ki | 3296±n/a nM |
---|
Citation | Lin, X; Huang, XP; Chen, G; Whaley, R; Peng, S; Wang, Y; Zhang, G; Wang, SX; Wang, S; Roth, BL; Huang, N Life beyond kinases: structure-based discovery of sorafenib as nanomolar antagonist of 5-HT receptors. J Med Chem55:5749-59 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 5A |
---|
Name: | 5-hydroxytryptamine receptor 5A |
Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
Type: | Enzyme |
Mol. Mass.: | 40266.25 |
Organism: | Homo sapiens (Human) |
Description: | P47898 |
Residue: | 357 |
Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
BDBM16673 |
---|
n/a |
---|
Name | BDBM16673 |
Synonyms: | 4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide | 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid | BAY 43-9006 | BAY 439006 | BAY439006 | CHEMBL1336 | Hit compound, 8 | Nexavar | Sorafenib | Sorafenib, 4 | US10183928, Sorafenib | US10202365, Compound Sorafenib | US10227329, Compound Sorafenib | US10584114, Compound Sorafenib | US10774070, Compound Sorafenib | US10980809, Example Sorafenib | US11279688, Compound Sorafenib | US11505527, Compound Sorafenib | US9029401, Sorafenib | US9469639, Sorafenib | US9902709, Comparative example 1 | Xarelto | cid_216239 |
Type | Small organic molecule |
Emp. Form. | C21H16ClF3N4O3 |
Mol. Mass. | 464.825 |
SMILES | CNC(=O)c1cc(Oc2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2)ccn1 |
Structure |
|