| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50395160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_859792 (CHEMBL2169620) |
|---|
| Ki | 3.62±n/a nM |
|---|
| Citation |  Baraldi, PG; Saponaro, G; Moorman, AR; Romagnoli, R; Preti, D; Baraldi, S; Ruggiero, E; Varani, K; Targa, M; Vincenzi, F; Borea, PA; Aghazadeh Tabrizi, M 7-Oxo-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxamides as selective CB(2) cannabinoid receptor ligands: structural investigations around a novel class of full agonists. J Med Chem55:6608-23 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50395160 |
|---|
| n/a |
|---|
| Name | BDBM50395160 |
|---|
| Synonyms: | CHEMBL2163938 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H34N2O3 |
|---|
| Mol. Mass. | 434.5705 |
|---|
| SMILES | CCCC1COc2cccc3c2n1cc(C(=O)NC12CC4CC(C)(CC(C)(C4)C1)C2)c3=O |TLB:27:25:29:21.20.19,27:20:24.25.28:29,26:25:29:21.20.19,THB:19:20:24:28.18.29,19:18:24:21.27.20| |
|---|
| Structure | 
|
|---|
Search and Browse
