| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50152162 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_860644 (CHEMBL2167784) |
|---|
| Ki | 1.7±n/a nM |
|---|
| Citation |  Deskus, JA; Dischino, DD; Mattson, RJ; Ditta, JL; Parker, MF; Denhart, DJ; Zuev, D; Huang, H; Hartz, RA; Ahuja, VT; Wong, H; Mattson, GK; Molski, TF; Grace, JE; Zueva, L; Nielsen, JM; Dulac, H; Li, YW; Guaraldi, M; Azure, M; Onthank, D; Hayes, M; Wexler, E; McDonald, J; Lodge, NJ; Bronson, JJ; Macor, JE [18F](R)-5-chloro-1-(1-cyclopropyl-2-methoxyethyl)-3-(4-(2-fluoroethoxy)-2,5-dimethyl phenylamino)pyrazin-2(1H)-one: introduction of N3-phenylpyrazinones as potential CRF-R1 PET imaging agents. Bioorg Med Chem Lett22:6651-5 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF-R2 Alpha | CRF1 | CRFR | CRFR1 | CRFR1_HUMAN | CRH-R 1 | CRHR | CRHR1 | Corticotropin releasing factor receptor 1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 50744.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34998 |
|---|
| Residue: | 444 |
|---|
| Sequence: | MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50152162 |
|---|
| n/a |
|---|
| Name | BDBM50152162 |
|---|
| Synonyms: | CHEMBL188844 | CHEMBL2165204 | [3-(6-Dimethylamino-pyridin-3-yl)-2,5-dimethyl-pyrazolo[1,5-a]pyrimidin-7-yl]-dipropyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H30N6 |
|---|
| Mol. Mass. | 366.5031 |
|---|
| SMILES | CCCN(CCC)c1cc(C)nc2c(c(C)nn12)-c1ccc(nc1)N(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
