Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM50132437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861813
EC50>10000±n/a nM
Citation Singh RMasuda ESPayan DG Discovery and development of spleen tyrosine kinase (SYK) inhibitors. J Med Chem 55:3614-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:71541.93
Organism:Rattus norvegicus
Description:ChEMBL_1348392
Residue:629
Sequence:
MAGNAVDNANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKA
HHYTIERELNGTYAISGGRAHASPADLCHYHSQEPEGLVCLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQT
VLIGSKTNGKFLIRARDNNGSFALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGVQMGHPGSSNAHPVTWSPGGIISRIKSYSFPKPGHKKP
PPPQGSRPESTVSFNPYEPTGGAWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLD
RKLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAAWGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLE
ESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINY
FKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREMYDLMF
LCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132437
n/a
NameBDBM50132437
Synonyms:3-((1-(3-hydroxypropyl)-5-methoxy-1H-indol-3-yl)methylene)-2-oxoindoline-5-sulfonamide | 3-[1-[1-(3-Hydroxy-propyl)-5-methoxy-1H-indol-3-yl]-meth-(Z)-ylidene]-2-oxo-2,3-dihydro-1H-indole-5-sulfonic acid amide | CHEMBL107061
TypeSmall organic molecule
Emp. Form.C21H21N3O5S
Mol. Mass.427.474
SMILESCOc1ccc2n(CCCO)cc(\C=C3/C(=O)Nc4ccc(cc34)S(N)(=O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: