| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostate-specific antigen |
|---|
| Ligand | BDBM50396161 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_862794 (CHEMBL2172814) |
|---|
| Ki | 500±n/a nM |
|---|
| Citation |  Caliendo, G; Santagada, V; Perissutti, E; Severino, B; Fiorino, F; Frecentese, F; Juliano, L Kallikrein protease activated receptor (PAR) axis: an attractive target for drug development. J Med Chem55:6669-86 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostate-specific antigen |
|---|
| Name: | Prostate-specific antigen |
|---|
| Synonyms: | APS | Gamma-seminoprotein | KLK3 | KLK3_HUMAN | Kallikrein-3 | P-30 antigen | PSA | Prostate specific antigen | Prostate-specific antigen | Semenogelase | Seminin |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28747.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_959198 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
|
|
|
|---|
| BDBM50396161 |
|---|
| n/a |
|---|
| Name | BDBM50396161 |
|---|
| Synonyms: | CHEMBL2171879 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16N4O3 |
|---|
| Mol. Mass. | 324.3339 |
|---|
| SMILES | COc1ccc(cc1OC)C(=O)n1nc(nc1C)-c1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
