Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 3
LigandBDBM50397494
Substrate/Competitorn/a
Meas. Tech.ChEMBL_862020
Ki 0.631±n/a nM
Citation Bahl ABarton PBowers KBrough SEvans RLuckhurst CAMochel TPerry MWRigby ARiley RJSanganee HSisson ASpringthorpe B The discovery of CCR3/H1 dual antagonists with reduced hERG risk. Bioorg Med Chem Lett 22:6688-93 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 3
Name:C-C chemokine receptor type 3
Synonyms:C-C CKR-3 | C-C chemokine receptor type 3 (CCR3) | CC-CKR-3 | CCR-3 | CCR3 | CD_antigen=CD193 | CKR3 | Eosinophil eotaxin receptor
Type:Enzyme
Mol. Mass.:41053.88
Organism:Homo sapiens (Human)
Description:P51677
Residue:355
Sequence:
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397494
n/a
NameBDBM50397494
Synonyms:CHEMBL2171047
TypeSmall organic molecule
Emp. Form.C25H31Cl2N3O4S
Mol. Mass.540.502
SMILESCc1ccc(cc1)S(=O)(=O)NC(=O)N1CCC(CC1)N1CCC(CC1)Oc1ccc(Cl)c(C)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: