Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase haspin
LigandBDBM50364776
Substrate/Competitorn/a
Meas. Tech.ChEMBL_874451
IC50 34±n/a nM
Citation Drygin DHaddach MPierre FRyckman DM Potential use of selective and nonselective Pim kinase inhibitors for cancer therapy. J Med Chem 55:8199-208 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase haspin
Name:Serine/threonine-protein kinase haspin
Synonyms:Germ cell-specific gene 2 protein | H-haspin | Haploid germ cell-specific nuclear protein kinase
Type:PROTEIN
Mol. Mass.:88531.28
Organism:Homo sapiens (Human)
Description:ChEMBL_1510616
Residue:798
Sequence:
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364776
n/a
NameBDBM50364776
Synonyms:CHEMBL1952141 | CHEMBL1952329
TypeSmall organic molecule
Emp. Form.C20H22F3N5O
Mol. Mass.405.4168
SMILESCN1CCC(CNc2ccc3ncc(-c4cccc(OC(F)(F)F)c4)n3n2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: