Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 4 |
---|
Ligand | BDBM50398594 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_873995 (CHEMBL2185684) |
---|
EC50 | 1.2±n/a nM |
---|
Citation | Brodney, MA; Johnson, DE; Sawant-Basak, A; Coffman, KJ; Drummond, EM; Hudson, EL; Fisher, KE; Noguchi, H; Waizumi, N; McDowell, LL; Papanikolaou, A; Pettersen, BA; Schmidt, AW; Tseng, E; Stutzman-Engwall, K; Rubitski, DM; Vanase-Frawley, MA; Grimwood, S Identification of multiple 5-HT4 partial agonist clinical candidates for the treatment of Alzheimer's disease. J Med Chem55:9240-54 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 4 |
---|
Name: | 5-hydroxytryptamine receptor 4 |
Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
Type: | Enzyme |
Mol. Mass.: | 43767.54 |
Organism: | Homo sapiens (Human) |
Description: | Q13639 |
Residue: | 388 |
Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
BDBM50398594 |
---|
n/a |
---|
Name | BDBM50398594 |
Synonyms: | CHEMBL2179585 |
Type | Small organic molecule |
Emp. Form. | C22H32N2O3 |
Mol. Mass. | 372.5011 |
SMILES | CCCCN1CCC(COc2noc3cccc(OC4CCCC4)c23)CC1 |
Structure |
|