Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 4
LigandBDBM50399183
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876875
IC50 1760±n/a nM
Citation Hernandez-Olmos VAbdelrahman AEl-Tayeb AFreudendahl DWeinhausen SMüller CE N-substituted phenoxazine and acridone derivatives: structure-activity relationships of potent P2X4 receptor antagonists. J Med Chem 55:9576-88 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 4
Name:P2X purinoceptor 4
Synonyms:ATP receptor | P2X4 | P2rx4 | P2x4 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:43443.55
Organism:Mus musculus
Description:ChEMBL_1283887
Residue:388
Sequence:
MAGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIP
DKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAG
HSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYY
RDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYC
MKKRYYYRDKKYKYVEDYEQGLSGEMNQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399183
n/a
NameBDBM50399183
Synonyms:CHEMBL2180160
TypeSmall organic molecule
Emp. Form.C19H15NO3S
Mol. Mass.337.392
SMILESCc1ccc(cc1)S(=O)(=O)N1c2ccccc2Oc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: