Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50400132
Substrate/Competitorn/a
Meas. Tech.ChEMBL_878115
Ki 12±n/a nM
Citation Abdelhafez OMAmin KMAli HIAbdalla MMBatran RZ Synthesis of new 7-oxycoumarin derivatives as potent and selective monoamine oxidase A inhibitors. J Med Chem 55:10424-36 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase [flavin-containing] A | MAO-A | Monoamine oxidase A | Monoamine oxidase type A
Type:PROTEIN
Mol. Mass.:59764.63
Organism:Bos taurus
Description:ChEMBL_1501477
Residue:527
Sequence:
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLSAKDIWIQEPEAED
VPAVEITPSFWERNLPSVSGLLKIVGFSTSITALWFVMYRFRLLSRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400132
n/a
NameBDBM50400132
Synonyms:CHEMBL2178988
TypeSmall organic molecule
Emp. Form.C13H10N2O4S
Mol. Mass.290.295
SMILESCc1cc(=O)oc2cc(OCc3nnc(S)o3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: