| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM50400902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_880267 (CHEMBL2215845) |
|---|
| Ki | 33±n/a nM |
|---|
| Citation |  Bang-Andersen, B; Ruhland, T; Jørgensen, M; Smith, G; Frederiksen, K; Jensen, KG; Zhong, H; Nielsen, SM; Hogg, S; Mørk, A; Stensbøl, TB Discovery of 1-[2-(2,4-dimethylphenylsulfanyl)phenyl]piperazine (Lu AA21004): a novel multimodal compound for the treatment of major depressive disorder. J Med Chem54:3206-21 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM50400902 |
|---|
| n/a |
|---|
| Name | BDBM50400902 |
|---|
| Synonyms: | 1-(2-(2,4-dimethylphenylsulfanyl)phenyl)piperazine | CHEMBL2204360 | Lu-AA21004 | Trintellix | brintellix | vortioxetine hydrobromide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2S |
|---|
| Mol. Mass. | 298.446 |
|---|
| SMILES | Cc1ccc(Sc2ccccc2N2CCNCC2)c(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
