Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-ketoacyl-ACP synthase (KasA)
LigandBDBM50401027
Substrate/Competitorn/a
Meas. Tech.ChEMBL_881659
IC50 3800±n/a nM
Citation García ABocanegra-García VPalma-Nicolás JPRivera G Recent advances in antitubercular natural products. Eur J Med Chem 49:1-23 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-ketoacyl-ACP synthase (KasA)
Name:Beta-ketoacyl-ACP synthase (KasA)
Synonyms:β-ketoacyl-ACP synthase I (KasA) | 3-oxoacyl-[acyl-carrier-protein] synthase 1
Type:Protein
Mol. Mass.:43305.57
Organism:Mycobacterium tuberculosis
Description:P9WQD9
Residue:416
Sequence:
MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI
GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE
RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH
AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG
EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL
TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401027
n/a
NameBDBM50401027
Synonyms:CHEMBL2204380
TypeSmall organic molecule
Emp. Form.C18H30O3
Mol. Mass.294.429
SMILESCCCCCCCc1cc(O)c(CCCCCC)c(=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: