Reaction Details |
| Report a problem with these data |
Target | Thioredoxin, mitochondrial |
---|
Ligand | BDBM50366237 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_884453 (CHEMBL2212215) |
---|
Ki | 1310±n/a nM |
---|
Citation | Yang, J; Li, C; Ding, L; Guo, Q; You, Q; Jin, S Gambogic acid deactivates cytosolic and mitochondrial thioredoxins by covalent binding to the functional domain. J Nat Prod75:1108-16 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thioredoxin, mitochondrial |
---|
Name: | Thioredoxin, mitochondrial |
Synonyms: | MTRX | Mt-Trx | THIOM_HUMAN | TRX2 | TXN2 | Thioredoxin-2 |
Type: | PROTEIN |
Mol. Mass.: | 18386.61 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_884453 |
Residue: | 166 |
Sequence: | MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLT
TFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDD
HTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
|
|
|
BDBM50366237 |
---|
n/a |
---|
Name | BDBM50366237 |
Synonyms: | GAMBOGIC ACID |
Type | Small organic molecule |
Emp. Form. | C38H44O8 |
Mol. Mass. | 628.7512 |
SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-[#6][C@@]1([#6])[#8]-c2c(-[#6]\[#6]=[#6](\[#6])-[#6])c3-[#8][C@@]45[#6@H]6-[#6]-[#6@@H](-[#6]=[#6]4-[#6](=O)-c3c(-[#8])c2-[#6]=[#6]1)-[#6](=O)[C@]5([#6]\[#6]=[#6](\[#6])-[#6](-[#8])=O)[#8]C6([#6])[#6] |r,c:22,33,TLB:22:21:18:42.43,THB:33:32:18:42.43,43:19:23.22:34.32| |
Structure |
|