| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thioredoxin |
|---|
| Ligand | BDBM50366237 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_884454 (CHEMBL2212216) |
|---|
| Ki | 3110±n/a nM |
|---|
| Citation |  Yang, J; Li, C; Ding, L; Guo, Q; You, Q; Jin, S Gambogic acid deactivates cytosolic and mitochondrial thioredoxins by covalent binding to the functional domain. J Nat Prod75:1108-16 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thioredoxin |
|---|
| Name: | Thioredoxin |
|---|
| Synonyms: | ADF | ATL-derived factor | SASP | Surface-associated sulphydryl protein | THIO_HUMAN | TRDX | TRX | TRX1 | TXN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11732.84 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_934906 |
|---|
| Residue: | 105 |
|---|
| Sequence: | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
|
|
|
|---|
| BDBM50366237 |
|---|
| n/a |
|---|
| Name | BDBM50366237 |
|---|
| Synonyms: | GAMBOGIC ACID |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H44O8 |
|---|
| Mol. Mass. | 628.7512 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-[#6][C@@]1([#6])[#8]-c2c(-[#6]\[#6]=[#6](\[#6])-[#6])c3-[#8][C@@]45[#6@H]6-[#6]-[#6@@H](-[#6]=[#6]4-[#6](=O)-c3c(-[#8])c2-[#6]=[#6]1)-[#6](=O)[C@]5([#6]\[#6]=[#6](\[#6])-[#6](-[#8])=O)[#8]C6([#6])[#6] |r,c:22,33,TLB:22:21:18:42.43,THB:33:32:18:42.43,43:19:23.22:34.32| |
|---|
| Structure | 
|
|---|
Search and Browse
